Skip to content

Peptide Comparison Tool

Compare multiple peptides side-by-side across key parameters — class, sequence length, molecular weight, mechanism, and research applications. Request COA and product specification sheets for compared peptides.


Compare Peptides

Select 2–4 peptides to compare. Data is sourced from verified reference databases.

What This Calculator Does

Select two to four peptides and the tool assembles a side-by-side comparison matrix across the parameters that matter before a research decision: class, category, sequence length, molecular weight, mechanism of action, research applications, and standard purity specification. The matrix is generated from a built-in reference set of ten compounds, so results are consistent and reproducible run to run. The results panel also carries request links for Certificates of Analysis and product specification sheets.

Nothing is uploaded or stored — the comparison runs entirely in the browser from the built-in records. The sections below describe how the matrix is assembled, walk through a comparison, and note what the reference values do and do not tell you.

How the Comparison Matrix Is Built

The matrix is an assembly job rather than a computation: each selected peptide maps to a fixed record, and the table places those records in columns so the rows line up. A few consequences are worth knowing up front:

  • Values are reference figures. Lengths are residue counts in amino acids, molecular weights are reported in daltons to one decimal, and purity is the specification standard for the compound — not a measurement of any particular lot.
  • No ranking or scoring. The tool does not weight parameters or declare a winner; every row is presented at equal strength so you can apply your own criteria.
  • Fixed vocabulary. Categories (GLP-1, Tissue Repair, Cosmetic, Neuro, Sleep/Pineal, Growth Factors) group compounds by research area, which keeps cross-category comparisons readable.
  • One small-molecule guest. MK-677 (Ibutamoren) is included as a growth-hormone secretagogue reference; it is not a peptide, so its length row reads "N/A (small mol.)".

Worked Example

Compare the three metabolic peptides in the reference set — tirzepatide, semaglutide, and retatrutide — the way a literature-planning step would.

Step 1 — Select the compounds. Tick the tirzepatide, semaglutide, and retatrutide checkboxes (the three are pre-selected on load) and run the comparison.

Step 2 — Read down the mechanism row. The receptor profile separates them immediately:

Compound Mechanism of action
Tirzepatide GIP + GLP-1 receptor agonist
Semaglutide Selective GLP-1 receptor agonist
Retatrutide GIP + GLP-1 + glucagon receptor agonist

Step 3 — Check the structural rows. Length and mass agree with the mechanism row: tirzepatide and retatrutide are both 39-residue constructs with reported molecular weights of 4,813.5 Da and 4,840.6 Da, while semaglutide is the smaller 31-residue GLP-1 analogue at 4,113.6 Da. Two near-identical lengths with different receptor pharmacology is exactly the kind of gap a side-by-side table exposes quickly.

Step 4 — Note the shared specification. All three carry a ≥ 98% purity specification in the matrix, so purity does not discriminate between them — receptor breadth does.

Result: the walkthrough answers the planning question in one view — mechanism separates these compounds; size and purity specification do not — and the request buttons on the results panel carry the short list forward to COA requests.


How to Use This Comparison for Research Decisions

When selecting a peptide for research, the comparison matrix above provides a structured way to evaluate candidates across multiple dimensions. Here's how to use it effectively:

1. Compare by Core Parameters

Start by reviewing class, sequence length, molecular weight, and mechanism of action for each peptide. These parameters define the fundamental characteristics of each compound and determine its suitability for specific research applications.

  • Class tells you the peptide's functional category (e.g., GLP-1 agonist, tissue repair, neuropeptide) — peptides within the same class often share overlapping mechanisms
  • Length and MW affect stability, solubility, and administration considerations in research protocols
  • Mechanism of action is the most critical differentiator — two peptides targeting the same general area may work through entirely different pathways

2. Understand Key Category Differences

GLP-1 Agonists — Tirzepatide vs. Semaglutide vs. Retatrutide

These three metabolic peptides illustrate how subtle receptor-targeting differences can lead to distinct research applications:

Peptide Receptor Target Research Application
Tirzepatide GIP + GLP-1 (dual agonist) Dual pathway metabolic research, comparative efficacy studies
Semaglutide GLP-1 (selective agonist) Selective GLP-1 receptor studies, monotherapy models
Retatrutide GIP + GLP-1 + Glucagon (triple agonist) Triple agonism research, multi-receptor crosstalk studies

Tirzepatide's dual agonism activates both GIP and GLP-1 receptors, offering broader metabolic pathway research. Semaglutide's selective GLP-1 agonism provides a focused tool for studying GLP-1-specific effects. Retatrutide's triple agonism adds glucagon receptor activation, enabling research into combined energy expenditure and glycemic control pathways.

Tissue Repair — BPC-157 vs. TB-500

These two popular regenerative peptides work through fundamentally different mechanisms:

  • BPC-157 promotes angiogenesis (formation of new blood vessels) and systemic tissue protection, supporting recovery through improved blood supply to damaged tissues
  • TB-500 (Thymosin β4 fragment) binds actin and promotes cell migration, supporting tissue regeneration through cytoskeletal remodeling and cell motility

Using these peptides in combination for research can explore synergistic mechanisms — angiogenesis from BPC-157 paired with actin-binding cell migration from TB-500 addresses tissue repair through complementary pathways.

3. Apply Comparisons to Purchasing Decisions

The comparison matrix directly links to product pages and COA requests. After evaluating peptides side-by-side:

  • Use the product links in the comparison table to navigate directly to detailed specification sheets
  • Click Request COA to obtain Certificate of Analysis documentation for the peptides you've compared
  • Cross-reference molecular weight, sequence, and purity data against your research protocol requirements

Peptide Selection Guide

Use this quick-reference table to identify the best peptide for your specific research objective:

Research Goal Recommended Peptide(s) Reason
Metabolic / Weight Loss Research Tirzepatide or Semaglutide GLP-1 receptor agonism for metabolic pathway studies
Triple Agonism Research Retatrutide GIP + GLP-1 + glucagon triple receptor activation
Soft Tissue Recovery Research BPC-157 + TB-500 Synergistic angiogenesis + actin-binding mechanisms
Dermal / Anti-Aging Research GHK-Cu Copper-dependent collagen synthesis and matrikine signaling
Cognitive Enhancement Research Semax BDNF and NGF modulation for neuroprotection studies
Sleep / Pineal Function Research Epitalon Telomerase regulation and circadian rhythm modulation
GH Secretagogue Research MK-677 or Ipamorelin GHS receptor agonism for growth hormone pathway studies

This guide maps research goals to specific peptides, but always verify detailed specifications — including purity, sequence confirmation, and stability data — via the product pages and COA documentation.


Frequently Asked Questions

How do I know which peptide is right for my research?

Start by identifying your research goal (e.g., metabolic studies, tissue repair, cognitive function). Use the Peptide Selection Guide above to match your goal to a recommended peptide. Then use the comparison tool to evaluate 2–4 candidates side-by-side by class, mechanism, molecular weight, and research applications. Finally, review the detailed technical profiles at data.rplpeptides.com and request a Certificate of Analysis to verify purity and specifications.

What's the difference between GLP-1 agonists?

GLP-1 agonists differ primarily in their receptor selectivity profile. Semaglutide is a selective GLP-1 receptor agonist, targeting only the GLP-1 pathway. Tirzepatide is a dual agonist (GIP + GLP-1), activating two receptor systems simultaneously. Retatrutide is a triple agonist (GIP + GLP-1 + glucagon), adding glucagon receptor activation for broader metabolic research. The choice depends on whether your research requires single-pathway selectivity, dual-pathway comparison, or multi-receptor crosstalk analysis.

Can I compare peptides from different categories?

Yes — the comparison tool is designed to work across categories. You can select peptides from any combination of classes (e.g., a GLP-1 agonist alongside a tissue repair peptide). The matrix will display all key parameters side-by-side, allowing you to evaluate class, mechanism, and structural differences even across unrelated peptide families. This is useful for broad surveying or when designing multi-compound research protocols.

How do I request a Certificate of Analysis?

After selecting the peptides you'd like to compare, click the "Request COA →" button displayed in the comparison results. This will take you to the COA request form at rplpeptides.com/coa-request/ with the first compared peptide pre-selected. You can request COAs for any or all of the compared peptides from the form. Certificates include verified purity, sequence confirmation, and analytical data.

Where can I find more detailed technical data?

Visit data.rplpeptides.com for comprehensive technical profiles on each peptide, including detailed sequence information, structural data, stability studies, and research references. Product-specific specification sheets are also available from each product page at rplpeptides.com.


From Comparison to Purchase

The comparison matrix is more than a research tool — it's your bridge from product specifications to purchasing decisions.

How to Take the Next Steps

  1. Compare your candidates using the interactive tool above to evaluate class, mechanism, molecular weight, and applications side-by-side
  2. Visit data.rplpeptides.com for full technical profiles — each peptide's detailed characterization including sequence confirmation, analytical data, and research references
  3. Request a Certificate of Analysis from rplpeptides.com/coa-request/ to verify purity and specifications before purchase
  4. Browse and order from the complete product catalog — each product page links back to the corresponding comparison data

Why This Matters

The comparison tool links product specifications directly to research needs. Instead of jumping between datasheets, you can evaluate multiple candidates in a single view, match parameters to your protocol requirements, and proceed directly to documentation or purchase — all from one interface.

Browse All Products at rplpeptides.com →


Peptide Reference Data

Peptide Class Length MW (Da) Sequence (1-letter)
Tirzepatide GIP/GLP-1 Dual Agonist 39 4,813.5 YXGEGTFTSDYSILDSKKQRAKQFVQWLLAGGPSSGAPPPS
Semaglutide GLP-1 Agonist 31 4,113.6 HGEGTFTSDVSSYLEEQAAKEFIAWLVKGRG
Retatrutide Triple GIP/GLP-1/GCG 39 4,840.6 YXGEGTFTSDYSILDSKKQRAKQFVQWLLAGGPSSGAPPPS
BPC-157 Tissue Repair 15 1,419.5 GEPPPGKPADDAGLV
TB-500 Regenerative 5 500.5 Ac-SDKP
GHK-Cu Cosmetic 3 466.4 (complex) GHK
Semax Neuropeptide 7 706.8 MEHFPGP
Epitalon Pineal Regulator 4 375.4 AEDG
MK-677 GHS Agonist N/A (small mol.) 528.7 N/A

Using Comparison Results

The comparison tool helps you:

  1. Evaluate alternatives — Compare structural and functional differences between peptide candidates
  2. Inform purchasing decisions — Side-by-side parameter comparison for procurement
  3. Cross-reference with data.rplpeptides.com — Detailed technical profiles for each compound
  4. Request documentation — Direct CTA to COA requests and product specifications

Assumptions and Rounding

  • Fixed reference set. The matrix draws on ten built-in records; compounds outside the list cannot be compared, and the values are not editable.
  • Representative values. Molecular weights are rounded to one decimal place in daltons; purity figures are specification standards ("≥ 98%"), not analytical results for a specific batch.
  • No weighting model. Every row carries equal weight; the tool computes no score, rank, or recommendation.
  • Selection bounds. A comparison requires 2–4 compounds; fewer or more selections produce a prompt instead of a matrix.
  • Link behavior. The "Request COA" button passes the first compared compound to the request form as a query parameter; the remaining compounds are added on the form itself.

Input Definitions

Input What it means Units Allowed values
Peptide checkboxes The compounds that enter the matrix — Ten reference compounds: Tirzepatide, Semaglutide, Retatrutide, GHK-Cu, BPC-157, TB-500, Semax, Epitalon, MK-677, Ipamorelin
Selection count How many compounds a single comparison accepts compounds 2–4

The matrix is rebuilt on each press of the Compare button; changing the checkboxes alone does not update the current results until the button is pressed again.

Output Interpretation

The matrix has one row per parameter and one column per compound:

Row How to read it
Peptide Compound name from the reference set
Class Functional class (e.g., "GLP-1/GIP Dual Agonist")
Category Research grouping used across this site
Length Residue count; "N/A (small mol.)" for the non-peptide entry
Molecular Weight Reported mass in daltons, one decimal
Mechanism Receptor or pathway description — usually the deciding row
Research Applications Typical research contexts for the compound
Standard Purity Purity specification standard, not a lot measurement

Below the matrix, the request panel links to COA requests and the product catalogue. The matrix itself produces no calculated or scored output — the interpretation is entirely the comparison you make across columns.

Limitations

  • Ten compounds only. The reference set covers the most-requested compounds on this site; it is not a database, and other peptides need their own documentation.
  • Reference values, not lot data. Molecular weight, length, and purity entries are standard figures; always confirm against the COA or technical sheet for the actual batch.
  • No sequence-level comparison. The matrix compares summary parameters; it does not align sequences or compute similarity.
  • Condensed mechanism summaries. Mechanism lines are one-sentence pointers to the literature, not full pharmacology.
  • No scoring or recommendation. Nothing tells you which compound is "better" — that judgment depends on the research question.

The Author's Take

Position — in my view, a comparison table is a tool for eliminating candidates, not for selecting them; the column you end up circling is usually the mechanism row, not the numbers.

Reasoning. Gross parameters — length, mass, purity specification — rarely separate compounds competing for the same study; two 39-residue analogues can differ in receptor breadth more than in any figure the table prints. The faster path is to let the table cut the list to two or three mechanistically distinct options, then go read the primary literature for the survivors. I would also resist reading a shared "≥ 98%" row as a quality equivalence: that is a specification, and specifications are promises, not measurements. The certificate for the actual lot is where quality gets settled.

Disclosure. This is the author's opinion from working with peptide documentation, not a verified fact; weighting of criteria should follow your own study design.

The matrix condenses what longer comparisons explore in full: